PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000659260
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 299aa    MW: 33130.5 Da    PI: 6.2307
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000659260genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.51.1e-161562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd ll++++  +G g+W++ a+  g++Rt+k+c++rw++yl
    MDP0000659260 15 RGPWTLEEDNLLIHYIVNHGEGHWNSXAKLAGLKRTGKSCRLRWLNYL 62
                     89********************************************97 PP

2Myb_DNA-binding50.83.7e-1668111146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T++E++ +++++ ++G++ W++Ia++++ gRt++++k++w++
    MDP0000659260  68 RGNLTPQEQLMILELHSKWGNR-WSKIAQHLP-GRTDNEIKNYWRT 111
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.4941062IPR017930Myb domain
SuperFamilySSF466891.06E-2913109IPR009057Homeodomain-like
SMARTSM007176.2E-131464IPR001005SANT/Myb domain
PfamPF002492.6E-151562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-211669IPR009057Homeodomain-like
CDDcd001673.70E-111762No hitNo description
PROSITE profilePS5129425.21263117IPR017930Myb domain
SMARTSM007175.4E-1567115IPR001005SANT/Myb domain
PfamPF002493.7E-1568111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.4E-2470116IPR009057Homeodomain-like
CDDcd001671.75E-1272111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009686Biological Processgibberellin biosynthetic process
GO:0009751Biological Processresponse to salicylic acid
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MAAPTTPNEE NEFRRGPWTL EEDNLLIHYI VNHGEGHWNS XAKLAGLKRT GKSCRLRWLN  60
YLKPDIKRGN LTPQEQLMIL ELHSKWGNRW SKIAQHLPGR TDNEIKNYWR TRVQKQARQL  120
NIESNSEQFL DAVRGFWVPT LLQKMEQSSS SCSSTLSTSQ NSASPCLSPN HAAPSVPLST  180
SPPSNATNVL DNYHISGNSN LATVPSNILS ADSFVSHVPQ MAEPSTSFPP AYYRLGYSSL  240
SPDGSHYVDS SSYDVEGLSL DPVSAMGNLG NSQFDCQMGG NDWMLDNVTD SLWNMDGP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-241211724128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.159970.0fruit| leaf
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00216DAPTransfer from AT1G68320Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744620.0DQ074462.1 Malus x domestica MYB7 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001280981.10.0transcription factor MYB21
TrEMBLQ2LMF00.0Q2LMF0_MALDO; MYB7
STRINGGLYMA20G25110.21e-101(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16393494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.13e-85myb domain protein 62
Publications ? help Back to Top
  1. Hellens RP, et al.
    Transient expression vectors for functional genomics, quantification of promoter activity and RNA silencing in plants.
    Plant Methods, 2005. 1: p. 13
    [PMID:16359558]